-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CREB3L3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-460 of human CREB3L3 (NP_001258924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CREB3L3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-460 of human CREB3L3 (NP_001258924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08706A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CREB3L3 |
| Target Synonyms | CREBH; HYTG2; CREB-H; HYST1481; CREB3L3 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 371-460 of human CREB3L3 (NP_001258924.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL | Uniprot ID | Q68CJ9 |
Uniprot Id
Q68CJ9
Target Species
Human
Target Name
CREB3L3
Target Full Name
Cyclic AMP-responsive element-binding protein 3-like protein 3
Target Function
Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activates transcription through box-B element. Activates transcription through CRE. May function synergistically with ATF6. In acute inflammatory response, may activate expression of acute phase response (APR) genes. May be involved in growth suppression. Regulates FGF21 transcription.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.; [Processed cyclic AMP-responsive element-binding protein 3-like protein 3]: Nucleus. Note=Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
Target Protein Families
BZIP family, ATF subfamily
Target Tissue Specificity
Exclusively expressed in liver. Underexpressed in hepatocellular carcinoma tissues.
Target Synonyms
CREB3L3; CREBH; HYST1481Cyclic AMP-responsive element-binding protein 3-like protein 3; cAMP-responsive element-binding protein 3-like protein 3; Transcription factor CREB-H) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 3]
Target Background
This gene encodes a member of the basic-leucine zipper family and the AMP-dependent transcription factor family. The encoded protein is localized to the endoplasmic reticulum and acts as a transcription factor activated by cyclic AMP stimulation. The encoded protein binds the cyclic AMP response element (CRE) and the box-B element and has been linked to acute inflammatory response, hepatocellular carcinoma, triglyceride metabolism, and hepcidin expression. Alternative splicing results in multiple transcript variants.
Notification