-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08831A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCG4 |
| Target Synonyms | WHITE2; ABCG4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, Mouse brain, U-87MG, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATST | Uniprot ID | Q9H172 |
Uniprot Id
Q9H172
Target Species
Human
Target Name
ABCG4
Target Full Name
ATP-binding cassette sub-family G member 4
Target Function
ATP-dependent transporter of the ATP-binding cassette (ABC) family that may be involved in the cellular efflux of sterols, in particular cholesterol and desmosterol (a cholesterol precursor), to high-density lipoprotein (HDL). May play an important role in the removal of amyloid-beta peptides from brain, in a process that can be antagonized by desmosterol. However it is unclear whether ABCG4 can directly transport amyloid-beta peptides or whether peptide export may be facilitated due to changes in the membrane lipid environment. Induces apoptosis in various cells.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Target Tissue Specificity
Expressed specifically in the brain and the eye.
Target Synonyms
ABCG4; WHITE2; ATP-binding cassette sub-family G member 4
Target Background
The protein encoded by this gene is a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein is a member of the White subfamily and plays an important role in cellular cholesterol homeostasis. This protein functions as either a homodimer or as a heterodimer with another ABC subfamily protein such as ABCG1.
Notification