Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL36AL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RPL36AL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08834A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL36AL |
| Target Synonyms | RPL36A; RPL36AP42; RPL36A_18_1363; RPL36AL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, A-549, Jurkat, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF | Uniprot ID | Q969Q0 |
Uniprot Id
Q969Q0
Target Species
Human
Target Name
RPL36AL
Target Full Name
Ribosomal protein eL42-like
Target Subcellular Location
Cytoplasm.
Target Protein Families
Eukaryotic ribosomal protein eL42 family
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
RPL36AL; 60S ribosomal protein L36a-like; Large ribosomal subunit protein eL42-like
Target Background
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which shares sequence similarity with yeast ribosomal protein L44, belongs to the L44E (L36AE) family of ribosomal proteins. This gene and the human gene officially named ribosomal protein L36a (RPL36A) encode nearly identical proteins; however, they are distinct genes. Although the name of this gene has been referred to as ribosomal protein L36a (RPL36A), its official name is ribosomal protein L36a-like (RPL36AL). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
