Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM20A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human FAM20A (NP_060035.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FAM20A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human FAM20A (NP_060035.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08987A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM20A |
| Target Synonyms | AI1G; AIGFS; FP2747; FAM20A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse small intestine, Rat liver, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human FAM20A (NP_060035.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMR | Uniprot ID | Q96MK3 |
Uniprot Id
Q96MK3
Target Species
Human
Target Name
FAM20A
Target Full Name
Pseudokinase FAM20A
Target Function
Pseudokinase that acts as an allosteric activator of the Golgi serine/threonine protein kinase FAM20C and is involved in biomineralization of teeth. Forms a complex with FAM20C and increases the ability of FAM20C to phosphorylate the proteins that form the 'matrix' that guides the deposition of the enamel minerals.
Target Involvement
Amelogenesis imperfecta 1G (AI1G)
Target Subcellular Location
Secreted. Golgi apparatus. Endoplasmic reticulum.
Target Protein Families
FAM20 family
Target Tissue Specificity
Highly expressed in lung and liver. Intermediate levels in thymus and ovary.
Target Research Area
Cell Biology
Target Synonyms
FAM20A; UNQ9388/PRO34279Pseudokinase FAM20A
Target Background
This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation at this locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
