Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CIZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-440 of human CIZ1 (NP_001124490) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CIZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-440 of human CIZ1 (NP_001124490) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09001A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CIZ1 |
| Target Synonyms | NP94; LSFR1; ZNF356; CIZ1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-440 of human CIZ1 (NP_001124490). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGQLQVKAQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQVQPQLQQEAEPQKQVQPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQN | Uniprot ID | Q9ULV3 |
Uniprot Id
Q9ULV3
Target Species
Human
Target Name
CIZ1
Target Full Name
Cip1-interacting zinc finger protein
Target Function
May regulate the subcellular localization of CIP/WAF1.
Target Involvement
Defects in CIZ1 may be a cause of adult onset primary cervical dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Cervical dystonia or spasmodic torticollis, the most common form of focal dystonia, is characterized by involuntary contractions of the neck muscles, which produce abnormal posturing of the head upon the trunk.
Target Subcellular Location
Nucleus.
Target Synonyms
CDKI; CDKN1A-interacting zinc finger protein 1; Cip1-interacting zinc finger protein; CIZ1; CIZ1_HUMAN; cyclin dependent inhibitor 1A; LSFR1; Melanoma differentiation-associated protein; NP94; Nuclear protein NP94; OPHN3; P21; Zinc finger protein 356; ZNF356
Target Background
The protein encoded by this gene is a zinc finger DNA binding protein that interacts with CIP1, part of a complex with cyclin E. The encoded protein may regulate the cellular localization of CIP1. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
