-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIAA0101 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIAA0101 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09046A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIAA0101 |
| Target Synonyms | L5; PAF; OEATC; PAF15; OEATC1; p15PAF; NS5ATP9; OEATC-1; p15/PAF; KIAA0101; p15(PAF) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE | Uniprot ID | Q15004 |
Uniprot Id
Q15004
Target Species
Human
Target Name
PCLAF
Target Full Name
PCNA-associated factor
Target Function
PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Target Subcellular Location
Nucleus. Cytoplasm, perinuclear region. Note=Following DNA damage, localizes to DNA damage sites (PubMed:21628590). Colocalizes with centrosomes in perinuclear region (PubMed:21673012).
Target Tissue Specificity
Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas, adrenocortical carcinomas, and in non-small-cell lung cancer l
Target Research Area
Metabolism
Target Synonyms
HCV NS5A transactivated protein 9 ; HCV NS5A-transactivated protein 9; Hepatitis C virus NS5A transactivated protein 9; Hepatitis C virus NS5A-transactivated protein 9; KIAA0101; L5; NS5 ATP9; NS5ATP9; OEATC 1; OEATC; OEATC-1; OEATC1; Overexpressed in anaplastic thyroid carcinoma 1; p15(PAF); p15PAF; PAF; PAF_HUMAN; PCNA associated factor; PCNA-associated factor
Target Background
Enables chromatin binding activity. Involved in several processes, including cellular macromolecule biosynthetic process; centrosome cycle; and response to UV. Located in centrosome; nucleus; and perinuclear region of cytoplasm.
Notification