-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNT-V/MGAT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human GNT-V/MGAT5 (NP_002401.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNT-V/MGAT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human GNT-V/MGAT5 (NP_002401.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09101A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNT-V/MGAT5 |
| Target Synonyms | GNT-V; GNT-VA; MGAT5A; glcNAc-T V; GNT-V/MGAT5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse testis, Mouse thymus, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human GNT-V/MGAT5 (NP_002401.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL | Uniprot ID | Q09328 |
Uniprot Id
Q09328
Target Species
Human
Target Name
MGAT5
Target Full Name
Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
Target Function
Catalyzes the addition of N-acetylglucosamine (GlcNAc) in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. Catalyzes an important step in the biosynthesis of branched, complex-type N-glycans, such as those found on EGFR, TGFR (TGF-beta receptor) and CDH2. Via its role in the biosynthesis of complex N-glycans, plays an important role in the activation of cellular signaling pathways, reorganization of the actin cytoskeleton, cell-cell adhesion and cell migration. MGAT5-dependent EGFR N-glycosylation enhances the interaction between EGFR and LGALS3 and thereby prevents rapid EGFR endocytosis and prolongs EGFR signaling. Required for efficient interaction between TGFB1 and its receptor. Enhances activation of intracellular signaling pathways by several types of growth factors, including FGF2, PDGF, IGF, TGFB1 and EGF. MGAT5-dependent CDH2 N-glycosylation inhibits CDH2-mediated homotypic cell-cell adhesion and contributes to the regulation of downstream signaling pathways. Promotes cell migration. Contributes to the regulation of the inflammatory response. MGAT5-dependent TCR N-glycosylation enhances the interaction between TCR and LGALS3, limits agonist-induced TCR clustering, and thereby dampens TCR-mediated responses to antigens. Required for normal leukocyte evasation and accumulation at sites of inflammation. Inhibits attachment of monocytes to the vascular endothelium and subsequent monocyte diapedesis.; Promotes proliferation of umbilical vein endothelial cells and angiogenesis, at least in part by promoting the release of the growth factor FGF2 from the extracellular matrix.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.; [Secreted alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A]: Secreted.
Target Protein Families
Glycosyltransferase 18 family
Target Synonyms
6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A; 6-N-acetylglucosaminyltransferase; Alpha 1,3(6) mannosylglycoprotein; Alpha 1,6 mannosylglycoprotein 6 beta N acetylglucosaminyltransferase; Alpha mannoside beta 1,6 N acetylglucosaminyltransferase; Alpha-1; Alpha-mannoside beta-1; Beta 1,6 N acetyl glucosaminyltransferase; GGNT5; GlcNAc T V; GlcNAc-T V; GNT V; GNT VA; GNT-V; GNTV; GNTVA; Mannoside acetylglucosaminyltransferase 5; Mannosyl (alpha 1,6) glycoprotein beta 1,6 N acetyl glucosaminyltransferase ; Mgat5; MGT5A_HUMAN; N acetylglucosaminyl transferase V; N acetylglucosaminyltransferase V mannosyl (alpha 1,6) glycoprotein; N-acetylglucosaminyl-transferase V
Target Background
The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1, 6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies.
Notification