Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 593-792 of human RRM1 (NP_001024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against RRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 593-792 of human RRM1 (NP_001024.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-09176A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RRM1 |
| Target Synonyms | R1; RR1; RIR1; RRM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse testis, Raji, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 593-792 of human RRM1 (NP_001024.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS | Uniprot ID | P23921 |
Uniprot Id
P23921
Target Species
Human
Target Name
RRM1
Target Full Name
Ribonucleoside-diphosphate reductase large subunit
Target Function
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Ribonucleoside diphosphate reductase large chain family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
R1; Ribonucleoside diphosphate reductase large subunit; Ribonucleoside diphosphate reductase M1 chain; Ribonucleoside diphosphate reductase subunit M1; Ribonucleoside reductase; large subunit; Ribonucleoside-diphosphate reductase large subunit; Ribonucleoside-diphosphate reductase subunit M1; Ribonucleotide reductase large chain; Ribonucleotide reductase large subunit; Ribonucleotide reductase M1; Ribonucleotide reductase M1 polypeptide; Ribonucleotide reductase R1 subunit ; Ribonucleotide reductase; M1 subunit; RIR 1; RIR1; RIR1_HUMAN; RR 1; RR1; RRM 1; RRM1
Target Background
This gene encodes the large and catalytic subunit of ribonucleotide reductase, an enzyme essential for the conversion of ribonucleotides into deoxyribonucleotides. A pool of available deoxyribonucleotides is important for DNA replication during S phase of the cell cycle as well as multiple DNA repair processes. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
