-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human PAK4 (NP_005875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PAK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human PAK4 (NP_005875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAK4 |
| Target Synonyms | PAK4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LNCaP, Mouse brain, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PAK4 (NP_005875.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLD | Uniprot ID | O96013 |
Uniprot Id
O96013
Target Species
Human
Target Name
PAK4
Target Full Name
Serine/threonine-protein kinase PAK 4
Target Function
Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, growth, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates and inactivates the protein phosphatase SSH1, leading to increased inhibitory phosphorylation of the actin binding/depolymerizing factor cofilin. Decreased cofilin activity may lead to stabilization of actin filaments. Phosphorylates LIMK1, a kinase that also inhibits the activity of cofilin. Phosphorylates integrin beta5/ITGB5 and thus regulates cell motility. Phosphorylates ARHGEF2 and activates the downstream target RHOA that plays a role in the regulation of assembly of focal adhesions and actin stress fibers. Stimulates cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Alternatively, inhibits apoptosis by preventing caspase-8 binding to death domain receptors in a kinase independent manner. Plays a role in cell-cycle progression by controlling levels of the cell-cycle regulatory protein CDKN1A and by phosphorylating RAN.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Highest expression in prostate, testis and colon.
Target Research Area
Apoptosis
Target Synonyms
KIAA1142; p21 activated kinase 4; p21 Cdc42/Rac1-actiated kinase 4; P21 protein (Cdc42/Rac) activated kinase 4; p21(CDKN1A) activated kinase 4; p21-activated kinase 4; PAK 4; PAK-4; Pak4; PAK4_HUMAN; Protein kinase related to S.cerevisiae STE20 effector for Cdc42Hs; Serine threonine kinase PAK 4; Serine/threonine protein kinase PAK 4; Serine/threonine protein kinase PAK4; Serine/threonine-protein kinase PAK 4
Target Background
PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification