-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YWHAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 146-245 of human YWHAZ (NP_003397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against YWHAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 146-245 of human YWHAZ (NP_003397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09301A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YWHAZ |
| Target Synonyms | HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta; YWHAZ | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, A-549, MCF7, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 146-245 of human YWHAZ (NP_003397.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN | Uniprot ID | P63104 |
Uniprot Id
P63104
Target Species
Human
Target Name
YWHAZ
Target Full Name
14-3-3 protein zeta/delta
Target Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity.
Target Subcellular Location
Cytoplasm. Melanosome. Note=Located to stage I to stage IV melanosomes.
Target Protein Families
14-3-3 family
Target Research Area
Cell Biology
Target Synonyms
14 3 3 delta; 14 3 3 protein zeta/delta; 14 3 3 protein/cytosolic phospholipase A2; 14 3 3 zeta; 14-3-3 protein zeta/delta; 1433Z_HUMAN; Epididymis luminal protein 4; Epididymis secretory protein Li 3; HEL S 3; HEL4; KCIP-1; KCIP1; MGC111427; MGC126532; MGC138156; Phospholipase A2; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; delta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; zeta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; zeta polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein; zeta polypeptide; YWHAD; YWHAZ
Target Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
Notification