-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human LMO1 (NP_002306.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LMO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human LMO1 (NP_002306.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09308A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMO1 |
| Target Synonyms | TTG1; RBTN1; RHOM1; LMO1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human LMO1 (NP_002306.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ | Uniprot ID | P25800 |
Uniprot Id
P25800
Target Species
Human
Target Name
LMO1
Target Full Name
Rhombotin-1
Target Function
May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Target Involvement
A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Cysteine rich protein TTG 1; Cysteine rich protein TTG1; Cysteine-rich protein TTG-1; LIM domain only 1; LIM domain only protein 1; LMO 1; LMO-1; lmo1; MGC116692; RBTN 1; RBTN1; RBTN1_HUMAN; RHOM 1; RHOM1; Rhombotin 1; Rhombotin-1; Rhombotin1; T cell translocation protein 1; T-cell translocation protein 1; TTG 1; TTG1
Target Background
This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.
Notification