-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human PAX7 (NP_039236.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human PAX7 (NP_039236.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09343A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX7 |
| Target Synonyms | HUP1; RMS2; PAX7B; CMYP19; MYOSCO; PAX7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, C2C12, U-2 OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human PAX7 (NP_039236.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLV | Uniprot ID | P23759 |
Uniprot Id
P23759
Target Species
Human
Target Name
PAX7
Target Full Name
Paired box protein Pax-7
Target Function
Transcription factor that is involved in the regulation of muscle stem cells proliferation, playing a role in myogenesis and muscle regeneration.
Target Involvement
Rhabdomyosarcoma 2 (RMS2)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
FLJ37460; HUP1; OTTHUMP00000002534 ; Paired box 7; Paired box gene 7; Paired box homeotic gene 7; Paired box protein Pax-7; Paired domain gene 7; Paired domain gene HuP1; Pax7; PAX7 transcriptional factor ; PAX7/FKHR fusion gene, included; PAX7_HUMAN; PAX7B; RGD1564360; RMS2
Target Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene.
Notification