-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCND2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 501-630 of human KCND2 (NP_036413.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCND2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 501-630 of human KCND2 (NP_036413.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09521A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCND2 |
| Target Synonyms | RK5; KV4.2; KCND2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 501-630 of human KCND2 (NP_036413.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL | Uniprot ID | Q9NZV8 |
Uniprot Id
Q9NZV8
Target Species
Human
Target Name
KCND2
Target Full Name
A-type voltage-gated potassium channel KCND2
Target Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Mediates the major part of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials that are below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. Contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which regulates the circadian rhythm of locomotor activity. Functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5. Mediates the transient outward current I(to) in rodent heart left ventricle apex cells, but not in human heart, where this current is mediated by another family member. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3; channel properties depend on the type of pore-forming alpha subunits that are part of the channel. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3 or KCNIP4 strongly increases expression at the cell surface and thereby increases channel activity; it modulates the kinetics of channel activation and inactivation, shifts the threshold for channel activation to more negative voltage values, shifts the threshold for inactivation to less negative voltages and accelerates recovery after inactivation. Likewise, interaction with DPP6 or DPP10 promotes expression at the cell membrane and regulates both channel characteristics and activity.
Target Involvement
KNCD2 mutations have been found in a family with autism and epilepsy and may play a role in disease pathogenesis. Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Epilepsy is characterized by paroxysmal transient disturbances of the electrical activity of the brain that may be manifested as episodic impairment or loss of consciousness, abnormal motor phenomena, psychic or sensory disturbances, or perturbation of the autonomic nervous system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell junction, synapse. Perikaryon. Cell junction, synapse, postsynaptic cell membrane. Cell projection, dendritic spine. Cell junction.
Target Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.2/KCND2 sub-subfamily
Target Tissue Specificity
Detected in ovary, in corpus luteum and in granulosa and theca cells in the follicle (at protein level). Highly expressed throughout the brain. Detected in amygdala, caudate nucleus, cerebellum, hippocampus, substantia nigra and thalamus. Expression is no
Target Research Area
Transport
Target Synonyms
KCD2; KCND 2; KCND2; KCND2_HUMAN; KIAA1044; MGC119702; MGC119703; Potassium voltage gated channel Shal related subfamily member 2; Potassium voltage-gated channel subfamily D member 2; RK 5; RK5; Voltage gated potassium channel Kv4.2; Voltage gated potassium channel subunit Kv4.2; Voltage sensitive potassium channel; Voltage-gated potassium channel subunit Kv4.2
Target Background
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member mediates a rapidly inactivating, A-type outward potassium current which is not under the control of the N terminus as it is in Shaker channels.
Notification