Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against REG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-158 of human REG4 (NP_114433.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against REG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-158 of human REG4 (NP_114433.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09584A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | REG4 |
| Target Synonyms | GISP; RELP; REG-IV; REG4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach, Rat stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-158 of human REG4 (NP_114433.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP | Uniprot ID | Q9BYZ8 |
Uniprot Id
Q9BYZ8
Target Species
Human
Target Name
REG4
Target Full Name
Regenerating islet-derived protein 4
Target Function
Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in
Target Synonyms
Gastrointestinal secretory protein; GISP; Reg IV; REG like protein; REG-4; REG-like protein; Reg4; REG4_HUMAN; Regenerating gene type IV; Regenerating islet derived family member 4; Regenerating islet derived protein 4 precursor; Regenerating islet-derived protein 4; Regenerating islet-derived protein IV; REGIV; RELP
Target Background
Enables heparin binding activity and mannan binding activity. Predicted to act upstream of or within response to bacterium. Located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
