Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAMP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human VAMP4 (NP_003753.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VAMP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human VAMP4 (NP_003753.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09760A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAMP4 |
| Target Synonyms | VAMP-4; VAMP24; VAMP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, B cells, BT-474, Jurkat, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human VAMP4 (NP_003753.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCK | Uniprot ID | O75379 |
Uniprot Id
O75379
Target Species
Human
Target Name
VAMP4
Target Full Name
Vesicle-associated membrane protein 4
Target Function
Involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. May be a marker for this sorting pathway that is critical for remodeling the secretory response of granule.
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Note=Associated with trans Golgi network (TGN) and newly formed immature secretory granules (ISG). Not found on the mature secretory organelles.
Target Protein Families
Synaptobrevin family
Target Synonyms
VAMP4; Vesicle-associated membrane protein 4; VAMP-4
Target Background
Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
