-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-95 of human CCL19 (NP_006265.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CCL19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-95 of human CCL19 (NP_006265.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09814A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL19 |
| Target Synonyms | ELC; CKb11; MIP3B; MIP-3b; SCYA19; CCL19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-95 of human CCL19 (NP_006265.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR | Uniprot ID | Q99731 |
Uniprot Id
Q99731
Target Species
Human
Target Name
CCL19
Target Full Name
C-C motif chemokine 19
Target Function
May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Tissue Specificity
Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Target Research Area
Immunology
Target Synonyms
Beta chemokine exodus 3; Beta-chemokine exodus-3; C C chemokine ligand 19; C-C motif chemokine 19; CC chemokine ligand 19; CCL 19; CCL19; CCL19_HUMAN; Chemokine (C C motif) ligand 19; Chemokine (CC motif) ligand 19; Chemokine C C Motif Ligand 19; Chemokine CC Motif Ligand 19; CK beta 11; CK beta-11; CKb 11; CKb11; EBI 1 ligand chemokine; EBI1 ligand chemokine; ELC; Epstein-Barr virus-induced molecule 1 ligand chemokine; Exodus 3; Exodus3; Macrophage inflammatory protein 3 beta; MGC34433; MIP 3 beta; MIP 3B; MIP-3-beta; MIP-3b; MIP3 beta; MIP3B; OTTHUMP00000000531; SCYA 19; SCYA19; Small inducible cytokine A19; Small inducible cytokine subfamily A (Cys Cys) member 1; Small-inducible cytokine A19
Target Background
This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.
Notification