Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human CHD3 (NP_001005273.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human CHD3 (NP_001005273.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09892A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHD3 |
| Target Synonyms | ZFH; Mi-2a; SNIBCPS; Mi2-ALPHA; CHD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human CHD3 (NP_001005273.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD | Uniprot ID | Q12873 |
Uniprot Id
Q12873
Target Species
Human
Target Name
CHD3
Target Full Name
Chromodomain-helicase-DNA-binding protein 3
Target Function
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Involved in transcriptional repressiobn as part of the NuRD complex. Required for anchoring centrosomal pericentrin in both interphase and mitosis, for spindle organization and centrosome integrity.
Target Subcellular Location
Nucleus, PML body. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Widely expressed.
Target Synonyms
226; 2600010P09Rik; AF020312; ATP dependent helicase CHD3; ATP-dependent helicase Chd3; CHD-3; Chd3; CHD3_HUMAN; Chd7; Chromodomain-helicase-DNA-binding protein 3; hZFH; MGC40857; Mi 2 autoantigen 240 kDa protein; Mi 2a; Mi-2 autoantigen 240 kDa protein; Mi2 ALPHA; Mi2-alpha; Prp7; Prp9 1; ZFH; Zinc finger helicase; zinc-finger helicase (Snf2-like)
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
