-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADRB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ADRB2 (NP_000015.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ADRB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ADRB2 (NP_000015.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09912A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADRB2 |
| Target Synonyms | BAR; B2AR; ADRBR; ADRB2R; BETA2AR; ADRB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LNCaP, Mouse liver, PC-3, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ADRB2 (NP_000015.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNID | Uniprot ID | P07550 |
Uniprot Id
P07550
Target Species
Human
Target Name
ADRB2
Target Full Name
Beta-2 adrenergic receptor
Target Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome. Golgi apparatus.
Target Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
Target Research Area
Cardiovascular
Target Synonyms
ADRB2; ADRB2R; B2AR; Beta-2 adrenergic receptor; Beta-2 adrenoreceptor; Beta-2 adrenoceptor
Target Background
This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This receptor is also a transcription regulator of the alpha-synuclein gene, and together, both genes are believed to be associated with risk of Parkinson's Disease. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity, type 2 diabetes and cardiovascular disease.
Notification