Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD132/IL-2 R gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-369 of human CD132/IL-2 R gamma (NP_000197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD132/IL-2 R gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-369 of human CD132/IL-2 R gamma (NP_000197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09951A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD132/IL-2 R gamma |
| Target Synonyms | P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1; CD132/IL-2 R gamma | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, Raji, RAW264.7, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-369 of human CD132/IL-2 R gamma (NP_000197.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET | Uniprot ID | P31785 |
Uniprot Id
P31785
Target Species
Human
Target Name
IL2RG
Target Full Name
Cytokine receptor common subunit gamma
Target Function
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Target Involvement
Severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID); X-linked combined immunodeficiency (XCID)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.
Target Protein Families
Type I cytokine receptor family, Type 5 subfamily
Target Research Area
Cancer
Target Synonyms
IL2RG; Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132
Target Background
The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
