-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human MMP12 (NP_002417.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MMP12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human MMP12 (NP_002417.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09971A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MMP12 |
| Target Synonyms | ME; HME; MME; MMP-12; MMP12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MMP12 (NP_002417.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF | Uniprot ID | P39900 |
Uniprot Id
P39900
Target Species
Human
Target Name
MMP12
Target Full Name
Macrophage metalloelastase
Target Function
May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Peptidase M10A family
Target Tissue Specificity
Found in alveolar macrophages but not in peripheral blood monocytes.
Target Synonyms
EC 3.4.24.65; HME; Macrophage elastase; Macrophage metalloelastase; Macrophage metaloelastase; Matrix metallopeptidase 12 (macrophage elastase); Matrix metalloprotease 12; Matrix metalloproteinase-12; ME; MGC138506; MME; MMP 12; MMP-12; Mmp12; MMP12_HUMAN
Target Background
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease degrades soluble and insoluble elastin. This gene may play a role in aneurysm formation and mutations in this gene are associated with lung function and chronic obstructive pulmonary disease (COPD). This gene is part of a cluster of MMP genes on chromosome 11.
Notification