Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC28A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC28A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10009A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC28A2 |
| Target Synonyms | CNT2; HCNT2; SPNT1; HsT17153; SLC28A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, BxPC-3, HepG2, HT-29, Mouse spleen, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI | Uniprot ID | O43868 |
Uniprot Id
O43868
Target Species
Human
Target Name
SLC28A2
Target Full Name
Sodium/nucleoside cotransporter 2
Target Function
Sodium-dependent and purine-selective transporter. Exhibits the transport characteristics of the nucleoside transport system cif or N1 subtype (N1/cif) (selective for purine nucleosides and uridine). Plays a critical role in specific uptake and salvage of purine nucleosides in kidney and other tissues.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Concentrative nucleoside transporter (CNT) (TC 2.A.41) family
Target Tissue Specificity
Expressed in heart and skeletal muscle followed by liver, kidney, intestine, pancreas, placenta and brain. Weak expression in lung.
Target Synonyms
SLC28A2; CNT2; Sodium/nucleoside cotransporter 2; Concentrative nucleoside transporter 2; CNT 2; hCNT2; Na(+)/nucleoside cotransporter 2; Sodium-coupled nucleoside transporter 2; Sodium/purine nucleoside co-transporter; SPNT; Solute carrier family 28 member 2
Target Background
Enables neurotransmitter transmembrane transporter activity and nucleoside transmembrane transporter activity. Involved in several processes, including nucleoside transport; purine nucleobase transmembrane transport; and pyrimidine-containing compound transmembrane transport. Predicted to be located in membrane. Predicted to be part of brush border membrane; coated vesicle; and vesicle membrane. Predicted to be integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
