-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC52A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC52A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10033A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC52A3 |
| Target Synonyms | RFT2; BVVLS; RFVT3; hRFT2; BVVLS1; C20orf54; bA371L19.1; SLC52A3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL | Uniprot ID | Q9NQ40 |
Uniprot Id
Q9NQ40
Target Species
Human
Target Name
SLC52A3
Target Full Name
Solute carrier family 52, riboflavin transporter, member 3
Target Function
Plasma membrane transporter mediating the uptake by cells of the water soluble vitamin B2/riboflavin that plays a key role in biochemical oxidation-reduction reactions of the carbohydrate, lipid, and amino acid metabolism. Humans are unable to synthesize vitamin B2/riboflavin and must obtain it via intestinal absorption.
Target Involvement
Brown-Vialetto-Van Laere syndrome 1 (BVVLS1); Fazio-Londe disease (FALOND)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell membrane.; [Isoform 1]: Cell membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein. Cytoplasm.; [Isoform 2]: Cytoplasm.
Target Protein Families
Riboflavin transporter family
Target Tissue Specificity
Predominantly expressed in testis. Highly expressed in small intestine and prostate.
Target Synonyms
bA371L19.1; BVVLS; BVVLS1; C20orf54; C20orf54provided by HGNC; Chromosome 20 open reading frame 54; hRFT2; member 3; MGC10698; RFT2; RFVT3; Riboflavin transporter 2; riboflavin transporter; riboflavin transporter, member 3; S52A3_HUMAN; Slc52a3; solute carrier family 52 (riboflavin transporter), member 3; Solute carrier family 52; solute carrier family 52, riboflavin transporter, member 3
Target Background
This gene encodes a riboflavin transporter protein that is strongly expressed in the intestine and likely plays a role in intestinal absorption of riboflavin. The protein is predicted to have eleven transmembrane domains and a cell surface localization signal in the C-terminus. Mutations at this locus have been associated with Brown-Vialetto-Van Laere syndrome and Fazio-Londe disease.
Notification