Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RASGRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RASGRP2 (NP_722541.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RASGRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RASGRP2 (NP_722541.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10097A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RASGRP2 |
| Target Synonyms | CDC25L; CALDAG-GEFI; RASGRP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RASGRP2 (NP_722541.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLF | Uniprot ID | Q7LDG7 |
Uniprot Id
Q7LDG7
Target Species
Human
Target Name
RASGRP2
Target Full Name
RAS guanyl-releasing protein 2
Target Function
Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.
Target Involvement
Bleeding disorder, platelet-type 18 (BDPLT18)
Target Subcellular Location
Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein. Cell junction, synapse, synaptosome. Cell projection, ruffle membrane; Peripheral membrane protein.
Target Protein Families
RASGRP family
Target Tissue Specificity
Detected in platelets, neutrophils and T lymphocytes (at protein level). Expressed in brain where it is enriched in the striatum. Also expressed in the hematopoietic system. Detected in heart, brain, lung, placenta, liver, skeletal muscle and kidney.
Target Synonyms
Calcium and DAG-regulated; Calcium and DAG-regulated guanine nucleotide exchange factor I; Calcium-and diacylglycerol-regulated guanine nucleotide exchange factor I; CalDAG-GEFI; Cdc25 like protein; Cdc25-like protein; F25B3.3 kinase like protein; F25B3.3 kinase-like protein; GRP2_HUMAN; HCDC25L; RAS guanyl releasing protein 2; RAS guanyl-releasing protein 2; Rasgrp2
Target Background
The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
