-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SGMS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human SGMS1 (NP_671512.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SGMS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human SGMS1 (NP_671512.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10150A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SGMS1 |
| Target Synonyms | MOB; MOB1; SMS1; TMEM23; hmob33; SGMS1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human SGMS1 (NP_671512.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGK | Uniprot ID | Q86VZ5 |
Uniprot Id
Q86VZ5
Target Species
Human
Target Name
SGMS1
Target Full Name
Phosphatidylcholine:ceramide cholinephosphotransferase 1
Target Function
Major sphingomyelin synthase at the Golgi apparatus. Catalyzes the reversible transfer of phosphocholine moiety in sphingomyelin biosynthesis: in the forward reaction transfers phosphocholine head group of phosphatidylcholine (PC) on to ceramide (CER) to form ceramide phosphocholine (sphingomyelin, SM) and diacylglycerol (DAG) as by-product, and in the reverse reaction transfers phosphocholine from SM to DAG to form PC and CER. The direction of the reaction depends on the levels of CER and DAG in Golgi membranes. Does not use free phosphorylcholine or CDP-choline as donor. Regulates receptor-mediated signal transduction via mitogenic DAG and proapoptotic CER, as well as via SM, a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting. Plays a role in secretory transport via regulation of DAG pool at the Golgi apparatus and its downstream effects on PRKD1.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
Sphingomyelin synthase family
Target Tissue Specificity
Brain, heart, kidney, liver, muscle and stomach.
Target Synonyms
SGMS1; MOB; SMS1; TMEM23; Phosphatidylcholine:ceramide cholinephosphotransferase 1; Medulla oblongata-derived protein; Protein Mob; Sphingomyelin synthase 1; Transmembrane protein 23
Target Background
The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.
Notification