-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINB5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human SERPINB5 (NP_002630.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SERPINB5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human SERPINB5 (NP_002630.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10245A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINB5 |
| Target Synonyms | PI5; maspin; SERPINB5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, HT-29 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human SERPINB5 (NP_002630.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNK | Uniprot ID | P36952 |
Uniprot Id
P36952
Target Species
Human
Target Name
SERPINB5
Target Full Name
Serpin B5
Target Function
Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
Serpin family, Ov-serpin subfamily
Target Tissue Specificity
Normal mammary epithelial cells.
Target Synonyms
Maspin; Ovalbumin; Peptidase inhibitor 5; PI-5; PI5; protease inhibitor 5 (maspin); Protease inhibitor 5; Serine (or cysteine) peptidase inhibitor; clade B; member 5; serine (or cysteine) proteinase inhibitor; clade B (ovalbumin); member 5; Serpin B5; serpin family B member 5; Serpin peptidase inhibitor; Serpin peptidase inhibitor; clade B (ovalbumin); member 5; Serpinb5; SPB5_HUMAN; Spi5; Spi7
Target Background
Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within several processes, including extracellular matrix organization; prostate gland morphogenesis; and regulation of epithelial cell proliferation. Located in cytoplasm. Biomarker of hepatocellular carcinoma.
Notification