-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAZL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DAZL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10252A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAZL |
| Target Synonyms | DAZH; DAZL1; DAZLA; SPGYLA; DAZL | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR | Uniprot ID | Q92904 |
Uniprot Id
Q92904
Target Species
Human
Target Name
DAZL
Target Full Name
Deleted in azoospermia-like
Target Function
RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
RRM DAZ family
Target Tissue Specificity
Testis specific.
Target Research Area
Developmental Biology
Target Synonyms
DAZ homolog; DAZ like autosomal; DAZ-like autosomal; DAZH; DAZL 1; DAZL; DAZL_HUMAN; DAZL1; DAZLA; Deleted in azoospermia like 1; Deleted in azoospermia like; Deleted in azoospermia like autosomal; Deleted in azoospermia-like 1; Deleted in azoospermia-like; Germline specific RNA binding protein; MGC26406; Spermatogenesis gene on the Y like autosomal; SPGY like autosomal ; SPGY-like-autosomal; SPGYLA; Tpx2
Target Background
The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene.
Notification