Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ID4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ID4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10445A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ID4 |
| Target Synonyms | IDB4; bHLHb27; ID4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY | Uniprot ID | P47928 |
Uniprot Id
P47928
Target Species
Human
Target Name
ID4
Target Full Name
DNA-binding protein inhibitor ID-4
Target Function
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation.
Target Subcellular Location
Nucleus.
Target Synonyms
bHLHb27; Class B basic helix-loop-helix protein 27; DNA binding protein inhibitor ID 4; DNA binding protein inhibitor ID4; DNA-binding protein inhibitor ID-4; ID 4; Id4; ID4_HUMAN; IDB4; Inhibitor of DNA binding 4; Inhibitor of DNA binding 4 dominant negative helix loop helix protein
Target Background
This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
