Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human EAF1 (NP_149074.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human EAF1 (NP_149074.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10525A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EAF1 |
| Target Synonyms | EAF1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human EAF1 (NP_149074.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQ | Uniprot ID | Q96JC9 |
Uniprot Id
Q96JC9
Target Species
Human
Target Name
EAF1
Target Full Name
ELL-associated factor 1
Target Function
Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.
Target Subcellular Location
Nucleus speckle. Nucleus, Cajal body.
Target Protein Families
EAF family
Target Tissue Specificity
Strongly expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine and colon. Poorly expressed in thymus.
Target Synonyms
EAF1ELL-associated factor 1
Target Background
Enables transcription elongation regulator activity. Involved in regulation of transcription elongation from RNA polymerase II promoter. Located in intercellular bridge and nuclear body. Part of transcription elongation factor complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
