-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP5J was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human ATP5J (NP_001676.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ATP5J was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human ATP5J (NP_001676.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10767A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP5J |
| Target Synonyms | F6; CF6; ATP5; ATPM; ATP5A; ATP5J | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 22Rv1, NCI-H460, SW480, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human ATP5J (NP_001676.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA | Uniprot ID | P18859 |
Uniprot Id
P18859
Target Species
Human
Target Name
ATP5PF
Target Full Name
ATP synthase-coupling factor 6, mitochondrial
Target Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes.
Target Subcellular Location
Mitochondrion. Mitochondrion inner membrane.
Target Protein Families
Eukaryotic ATPase subunit F6 family
Target Research Area
Tags & Cell Markers
Target Synonyms
ATP synthase; H+ transporting; mitochondrial F0 complex; subunit F6; ATP synthase-coupling factor 6; mitochondrial; ATP synthase-coupling factor 6; mitochondrial; ATP5; ATP5A; ATP5J; ATP5J_HUMAN; ATPase subunit F6; ATPM; CF6; F6
Target Background
Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo complex has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the Fo complex. The F6 subunit is required for F1 and Fo interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has 1 or more pseudogenes.
Notification