-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 514-593 of human SHP2 (NP_002825.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SHP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 514-593 of human SHP2 (NP_002825.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10768A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHP2 |
| Target Synonyms | CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, NIH/3T3, 293T, Mouse brain, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 514-593 of human SHP2 (NP_002825.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR | Uniprot ID | Q06124 |
Uniprot Id
Q06124
Target Species
Human
Target Name
PTPN11
Target Full Name
Tyrosine-protein phosphatase non-receptor type 11
Target Function
Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Positively regulates MAPK signal transduction pathway. Dephosphorylates GAB1, ARHGAP35 and EGFR. Dephosphorylates ROCK2 at 'Tyr-722' resulting in stimulation of its RhoA binding activity. Dephosphorylates CDC73. Dephosphorylates SOX9 on tyrosine residues, leading to inactivate SOX9 and promote ossification.
Target Involvement
LEOPARD syndrome 1 (LPRD1); Noonan syndrome 1 (NS1); Leukemia, juvenile myelomonocytic (JMML); Metachondromatosis (MC)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class 2 subfamily
Target Tissue Specificity
Widely expressed, with highest levels in heart, brain, and skeletal muscle.
Target Research Area
Neuroscience
Target Synonyms
(Protein-tyrosine phosphatase 1D)(PTP-1D)(Protein-tyrosine phosphatase 2C)(PTP-2C)(SH-PTP2)(SHP-2)(Shp2)(SH-PTP3)
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
Notification