-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MUC20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MUC20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10819A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MUC20 |
| Target Synonyms | MUC-20; MUC20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-549, DU145, HT-29, LO2, Mouse lung, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD | Uniprot ID | Q8N307 |
Uniprot Id
Q8N307
Target Species
Human
Target Name
MUC20
Target Full Name
Mucin-20
Target Function
May regulate MET signaling cascade. Seems to decrease hepatocyte growth factor (HGF)-induced transient MAPK activation. Blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway. Inhibits HGF-induced proliferation of MMP1 and MMP9 expression.
Target Subcellular Location
Secreted. Apical cell membrane. Basolateral cell membrane. Cell projection, microvillus membrane.
Target Tissue Specificity
Highly expressed in kidney, moderately in placenta, lung, prostate, liver, and digestive system. In the kidney, localized in the proximal tubules but not in the glomerulus or distal tubules. Detected in most of the male urogenital tract epithelia, with th
Target Synonyms
MUC 20; MUC-20; Muc20; MUC20_HUMAN; Mucin 20; Mucin 20, cell surface associated; Mucin-20; Transmembrane mucin MUC20S
Target Background
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins secreted by many epithelial tissues to form an insoluble mucous barrier. The C-terminus of this family member associates with the multifunctional docking site of the MET proto-oncogene and suppresses activation of some downstream MET signaling cascades. The protein features a mucin tandem repeat domain that varies between two and six copies in most individuals. Multiple variants encoding different isoforms have been found for this gene. A related pseudogene, which is also located on chromosome 3, has been identified.
Notification