-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB35 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-201 of human RAB35 (NP_006852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RAB35 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-201 of human RAB35 (NP_006852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10954A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB35 |
| Target Synonyms | RAY; H-ray; RAB1C; RAB35 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-201 of human RAB35 (NP_006852.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC | Uniprot ID | Q15286 |
Uniprot Id
Q15286
Target Species
Human
Target Name
RAB35
Target Full Name
Ras-related protein Rab-35
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in the process of endocytosis and is an essential rate-limiting regulator of the fast recycling pathway back to the plasma membrane. During cytokinesis, required for the postfurrowing terminal steps, namely for intercellular bridge stability and abscission, possibly by controlling phosphatidylinositol 4,5-bis phosphate (PIP2) and SEPT2 localization at the intercellular bridge. May indirectly regulate neurite outgrowth. Together with TBC1D13 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Membrane, clathrin-coated pit. Cytoplasmic vesicle, clathrin-coated vesicle. Endosome. Melanosome.
Target Protein Families
Small GTPase superfamily, Rab family
Target Research Area
Cell Biology
Target Synonyms
GTP binding protein RAY; GTP-binding protein RAY; H ray; OTTHUMP00000240256; OTTHUMP00000240257; OTTHUMP00000240258; OTTHUMP00000240259; RAB1C; Rab35; RAB35 member RAS oncogene family; RAB35; member RAS oncogene family; RAB35_HUMAN; Ras related protein rab 1c (GTP binding protein ray); Ras related protein Rab 1C; Ras related protein Rab35; Ras-related protein Rab-1C; Ras-related protein Rab-35; RAY
Target Background
Enables GTPase activity; guanyl ribonucleotide binding activity; and phosphatidylinositol-4, 5-bisphosphate binding activity. Involved in several processes, including endosomal transport; plasma membrane to endosome transport; and protein localization to endosome. Located in several cellular components, including clathrin-coated endocytic vesicle; clathrin-coated pit; and intercellular bridge.
Notification