Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTSS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MTSS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10982A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTSS1 |
| Target Synonyms | MIM; MIMA; MIMB; MTSS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HT-29, Mouse brain, Mouse liver, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED | Uniprot ID | O43312 |
Uniprot Id
O43312
Target Species
Human
Target Name
MTSS1
Target Full Name
Protein MTSS 1
Target Function
May be related to cancer progression or tumor metastasis in a variety of organ sites, most likely through an interaction with the actin cytoskeleton.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
MTSS1 family
Target Tissue Specificity
Expressed in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood.
Target Synonyms
2310003N14Rik; BC024131; D130001D01Rik; DKFZp781P2223 ; FLJ44694; KIAA0429; metastasis suppressor 1; Metastasis suppressor protein 1; Metastasis suppressor YGL 1 ; Metastasis suppressor YGL-1; MGC37896; MIM; MIMA; MIMB; missing in metastasis; Missing in metastasis protein; mKIAA0429; MTSS 1; Mtss1; MTSS1_HUMAN
Target Background
Enables actin monomer binding activity; identical protein binding activity; and signaling receptor binding activity. Predicted to be involved in cellular response to fluid shear stress; negative regulation of epithelial cell proliferation; and urogenital system development. Predicted to act upstream of or within several processes, including actin filament polymerization; adherens junction maintenance; and magnesium ion homeostasis. Located in actin cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
