-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD115/CSF-1R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 873-972 of human CD115/CSF-1R (NP_005202.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD115/CSF-1R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 873-972 of human CD115/CSF-1R (NP_005202.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11265A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD115/CSF-1R |
| Target Synonyms | FMS; CSFR; FIM2; GPSC; HDLS; C-FMS; CD115; HDLS1; CSF-1R; BANDDOS; M-CSF-R; CD115/CSF-1R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 873-972 of human CD115/CSF-1R (NP_005202.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC | Uniprot ID | P07333 |
Uniprot Id
P07333
Target Species
Human
Target Name
CSF1R
Target Full Name
Macrophage colony-stimulating factor 1 receptor
Target Function
Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. In the central nervous system, may play a role in the development of microglia macrophages.
Target Involvement
Leukoencephalopathy, diffuse hereditary, with spheroids (HDLS)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Target Tissue Specificity
Expressed in bone marrow and in differentiated blood mononuclear cells.
Target Research Area
Cardiovascular
Target Synonyms
C FMS; CD 115; CD115; CD115 antigen; CFMS; Colony stimulating factor 1 receptor; Colony stimulating factor I receptor; CSF 1 R; CSF 1R; CSF-1 receptor; CSF-1-R; CSF1 R; CSF1R; CSF1R_HUMAN; CSFR; EC 2.7.10.1; FIM 2; FIM2; FMS; FMS proto oncogene; FMS protooncogene; HDLS; M-CSF Receptor; M-CSF-R; Macrophage colony stimulating factor 1 receptor; Macrophage colony stimulating factor I receptor; Macrophage colony-stimulating factor 1 receptor; McDonough feline sarcoma viral (v fms) oncogene homolog; MCSFR; Oncogen FMS; Proto-oncogene c-Fms; V-FMS McDonough feline sarcoma viral oncogen homolog; formerly
Target Background
The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. Expression of a splice variant from an LTR promoter has been found in Hodgkin lymphoma (HL), HL cell lines and anaplastic large cell lymphoma.
Notification