-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRCA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1400-1600 of BRCA2 (NP_000050.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against BRCA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1400-1600 of BRCA2 (NP_000050.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12574A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | brca2 |
| Target Synonyms | FAD; FACD; FAD1; GLM3; BRCC2; FANCD; PNCA2; FANCD1; XRCC11; BROVCA2; BRCA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1400-1600 of BRCA2 (NP_000050.3). | Immunogen Sequence | KESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNN |
|---|---|---|---|
| Uniprot ID | P51587 |
Uniprot Id
P51587
Target Species
Human
Target Name
BRCA2
Target Full Name
Breast cancer type 2 susceptibility protein
Target Function
Involved in double-strand break repair and/or homologous recombination. Binds RAD51 and potentiates recombinational DNA repair by promoting assembly of RAD51 onto single-stranded DNA (ssDNA). Acts by targeting RAD51 to ssDNA over double-stranded DNA, enabling RAD51 to displace replication protein-A (RPA) from ssDNA and stabilizing RAD51-ssDNA filaments by blocking ATP hydrolysis. Part of a PALB2-scaffolded HR complex containing RAD51C and which is thought to play a role in DNA repair by HR. May participate in S phase checkpoint activation. Binds selectively to ssDNA, and to ssDNA in tailed duplexes and replication fork structures. May play a role in the extension step after strand invasion at replication-dependent DNA double-strand breaks; together with PALB2 is involved in both POLH localization at collapsed replication forks and DNA polymerization activity. In concert with NPM1, regulates centrosome duplication. Interacts with the TREX-2 complex (transcription and export complex 2) subunits PCID2 and SEM1, and is required to prevent R-loop-associated DNA damage and thus transcription-associated genomic instability. Silencing of BRCA2 promotes R-loop accumulation at actively transcribed genes in replicating and non-replicating cells, suggesting that BRCA2 mediates the control of R-loop associated genomic instability, independently of its known role in homologous recombination.
Target Involvement
Breast cancer (BC); Pancreatic cancer 2 (PNCA2); Breast-ovarian cancer, familial, 2 (BROVCA2); Fanconi anemia complementation group D1 (FANCD1); Glioma 3 (GLM3)
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Tissue Specificity
Highest levels of expression in breast and thymus, with slightly lower levels in lung, ovary and spleen.
Target Synonyms
BRCA 2; BRCA1/BRCA2 containing complex subunit 2; Brca2; BRCA2; DNA repair associated; BRCA2_HUMAN; BRCC 2; BRCC2; Breast and ovarian cancer susceptibility gene early onset; breast and ovarian cancer susceptibility protein 2; Breast cancer 2 early onset; Breast Cancer 2 tumor suppressor; Breast cancer susceptibility protein BRCA2; Breast cancer type 2 susceptibility protein; BROVCA2; FACD; FAD 1; FAD; FAD1; FANCB; FANCD 1; FANCD; FANCD1; FANCD1 gene; Fanconi anemia complementation group D1; Fanconi anemia group D1 protein; GLM3; mutant BRCA2; OTTHUMP00000018803; OTTHUMP00000042401; PNCA2; XRCC11
Target Background
Inherited mutations in BRCA1 and this gene, BRCA2, confer increased lifetime risk of developing breast or ovarian cancer. Both BRCA1 and BRCA2 are involved in maintenance of genome stability, specifically the homologous recombination pathway for double-strand DNA repair. The largest exon in both genes is exon 11, which harbors the most important and frequent mutations in breast cancer patients. The BRCA2 gene was found on chromosome 13q12.3 in human. The BRCA2 protein contains several copies of a 70 aa motif called the BRC motif, and these motifs mediate binding to the RAD51 recombinase which functions in DNA repair. BRCA2 is considered a tumor suppressor gene, as tumors with BRCA2 mutations generally exhibit loss of heterozygosity (LOH) of the wild-type allele.
Notification