-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EZH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of EZH1 (NP_001982.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EZH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of EZH1 (NP_001982.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05172A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EZH1 |
| Target Synonyms | KMT6B; EZH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW264.7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of EZH1 (NP_001982.2). | Immunogen Sequence | GEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALP |
|---|---|---|---|
| Uniprot ID | Q92800 |
Uniprot Id
Q92800
Target Species
Human
Target Name
EZH1
Target Full Name
Histone-lysine N-methyltransferase EZH1
Target Function
Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation.
Target Subcellular Location
Nucleus. Note=Colocalizes with trimethylated 'Lys-27' of histone H3.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, EZ subfamily
Target Synonyms
Enhancer of zeste homolog 1 (Drosophila); Enhancer of zeste homolog 1; ENX-2; ENX2; Ezh1; EZH1_HUMAN; Histone-lysine N-methyltransferase EZH1
Target Background
EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity (Shen et al., 2008 [PubMed 19026780]).
Notification