Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GID1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana GID1A (NP_187163.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GID1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana GID1A (NP_187163.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GID1A |
| Target Synonyms | ATGID1A; GA INSENSITIVE DWARF1A; T12H1.8; T12H1_8; GID1A | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana GID1A (NP_187163.1). | Immunogen Sequence | DRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRA |
|---|---|---|---|
| Uniprot ID | Q9MAA7 |
Uniprot Id
Q9MAA7
Target Synonyms
ATGID1A; GA INSENSITIVE DWARF1A; T12H1.8; T12H1_8; GID1A
Target Background
Encodes a gibberellin (GA) receptor ortholog of the rice GA receptor gene (OsGID1). Has GA-binding activity, showing higher affinity to GA4. Interacts with DELLA proteins in vivo in the presence of GA4. The DELLA region alone can interact with GID1A in GA-dependent manner in a Y2H assay.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
