• Contact info@abtriva.com for inquiries and orders.
  • Chinese (Simplified)

  • English

  • German

  • Korean

  • Spanish

United States (English / $ USD)

Rabbit anti- GPX4 Polyclonal Antibody

The antibody against GPX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of GPX4 (NP_002076.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

ADA-12920A

The antibody against GPX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of GPX4 (NP_002076.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

Number
Order Exclusive Products Now

Request a Quote
High Purity LevelsPrecision and ReliabilityCustomization Options

Specifications


Cat.No ADA-12920A ClonalityPolyclonal
Host SpeciesRabbitTarget NameGPX4
Target SynonymsMCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPxFormLiquid
Species ReactivityHuman, Mouse, RatIsotypeIgG
Storage Buffer50% Glycerol, PBS with 0.05% proclin300, pH7.3.Purification MethodAffinity purification
Positive SamplesJurkatApplicationELISA, WB, IF/ICC, IHC-P

Immunogen Information


Immunogen DescriptionRecombinant fusion protein containing a sequence corresponding to amino acids 30-197 of GPX4 (NP_002076.2).Immunogen SequenceASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Uniprot IDP36969
Background Information
  • Uniprot Id

    P36969

  • Target Species

    Human

  • Target Name

    GPX4

  • Target Full Name

    Phospholipid hydroperoxide glutathione peroxidase GPX4

  • Target Function

    Essential antioxidant peroxidase that directly reduces phospholipid hydroperoxide even if they are incorporated in membranes and lipoproteins. Can also reduce fatty acid hydroperoxide, cholesterol hydroperoxide and thymine hydroperoxide. Plays a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation. Required to prevent cells from ferroptosis, a non-apoptotic cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species. The presence of selenocysteine (Sec) versus Cys at the active site is essential for life: it provides resistance to overoxidation and prevents cells against ferroptosis. The presence of Sec at the active site is also essential for the survival of a specific type of parvalbumin-positive interneurons, thereby preventing against fatal epileptic seizures. May be required to protect cells from the toxicity of ingested lipid hydroperoxides. Required for normal sperm development and male fertility. Essential for maturation and survival of photoreceptor cells. Plays a role in a primary T-cell response to viral and parasitic infection by protecting T-cells from ferroptosis and by supporting T-cell expansion. Plays a role of glutathione peroxidase in platelets in the arachidonic acid metabolism. Reduces hydroperoxy ester lipids formed by a 15-lipoxygenase that may play a role as down-regulator of the cellular 15-lipoxygenase pathway.

  • Target Involvement

    Spondylometaphyseal dysplasia, Sedaghatian type (SMDS)

  • Target Subcellular Location

    [Isoform Mitochondrial]: Mitochondrion.; [Isoform Cytoplasmic]: Cytoplasm.

  • Target Protein Families

    Glutathione peroxidase family

  • Target Tissue Specificity

    Present primarily in testis. Expressed in platelets (at protein level).

  • Target Research Area

    Cancer

  • Target Synonyms

    Glutathione peroxidase 4; GPX 4; GPX-4; GPX4; GPX4_HUMAN; GSHPx-4; MCSP; mitochondrial; PHGPx; Phospholipid hydroperoxidase; Phospholipid hydroperoxide glutathione peroxidase; Phospholipid hydroperoxide glutathione peroxidase mitochondrial; snGPx; snPHGPx; Sperm nucleus glutathione peroxidase

  • Target Background

    The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization.

Inquire Rabbit anti- GPX4 Polyclonal Antibody Now



AbTriva respects your privacy and protects your personal data in accordance with AbTriva. For more information, please see our data protection statement. *

Notification