-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 14-3-3 gamma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against 14-3-3 gamma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07803A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 14-3-3 gamma |
| Target Synonyms | DEE56; EIEE56; PPP1R170; 14-3-3GAMMA; 14-3-3 gamma | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, K-562, Mouse brain, U-251 MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA | Uniprot ID | P61981 |
Uniprot Id
P61981
Target Species
Human
Target Name
YWHAG
Target Full Name
14-3-3 protein gamma
Target Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
Target Subcellular Location
Cytoplasm.
Target Protein Families
14-3-3 family
Target Tissue Specificity
Highly expressed in brain, skeletal muscle, and heart.
Target Synonyms
14 3 3 gamma; 14 3 3 protein gamma; 14 3 3 protein gamma subtype; 14 3 3gamma; 14-3-3 protein gamma; 1433G_HUMAN; 3 monooxygenase/tryptophan 5 monooxgenase activation protein gamma polypeptide; KCIP 1; KCIP-1; KCIP1; N-terminally processed; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein gamma polypeptide; Ywhag
Target Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.
Notification