-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 67kDa Laminin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against 67kDa Laminin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14321A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 67kDa Laminin Receptor |
| Target Synonyms | SA; LBP; LRP; p40; uS2; 67LR; ICAS; lamR; 37LRP; LAMBR; LAMR1; LRP/LR; LBP/p40; NEM/1CHD4; 67kDa Laminin Receptor | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BxPC-3, PC-12, Raji, Rat pancreas, RAW264.7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS | Uniprot ID | P08865 |
Uniprot Id
P08865
Target Species
Human
Target Name
RPSA
Target Full Name
Small ribosomal subunit protein uS2
Target Function
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA.; (Microbial infection) Acts as a receptor for the Adeno-associated viruses 2,3,8 and 9.; (Microbial infection) Acts as a receptor for the Dengue virus.; (Microbial infection) Acts as a receptor for the Sindbis virus.; (Microbial infection) Acts as a receptor for the Venezuelan equine encephalitis virus.; (Microbial infection) Acts as a receptor for the pathogenic prion protein.; (Microbial infection) Acts as a receptor for bacteria.
Target Involvement
Asplenia, isolated congenital (ICAS)
Target Subcellular Location
Cell membrane. Cytoplasm. Nucleus.
Target Protein Families
Universal ribosomal protein uS2 family
Target Research Area
Cardiovascular
Target Synonyms
34/67 kDa laminin receptor; 37 kDa laminin receptor precursor; 37/67 kDa laminin receptor; 37LRP; 40S ribosomal protein SA; 67 kDa laminin receptor; 67LR; Colon carcinoma laminin binding protein; Colon carcinoma laminin-binding protein; LAMBR; Laminin receptor 1; Laminin-binding protein precursor p40; LAMR 1; LamR; LAMR1; LBP; LBP/p40; LRP; LRP/LR; Multidrug resistance associated protein MGr1 Ag; Multidrug resistance associated protein MGr1Ag; Multidrug resistance-associated protein MGr1-Ag; NEM/1CHD4; p40; Ribosomal Protein SA; rpsA; RSSA_HUMAN; SA
Target Background
Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Notification