Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 841-985 of human AARS2 (NP_065796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 841-985 of human AARS2 (NP_065796.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09182A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AARS2 |
| Target Synonyms | AARSL; LKENP; COXPD8; MTALARS; MT-ALARS; AARS2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, SKOV3, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 841-985 of human AARS2 (NP_065796.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRELLATVKMLQRRANTAIRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVVRQLCEQAPSTSVLLLSPQPMGKVLCACQVAQGAMPTFTAEAWALAVCSHMGGKAWGSRVVAQGTGSTTDLEAALSIAQTYALSQL | Uniprot ID | Q5JTZ9 |
Uniprot Id
Q5JTZ9
Target Species
Human
Target Name
AARS2
Target Full Name
Alanine--tRNA ligase, mitochondrial
Target Function
Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
Target Involvement
Combined oxidative phosphorylation deficiency 8 (COXPD8); Leukoencephalopathy, progressive, with ovarian failure (LKENP)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Class-II aminoacyl-tRNA synthetase family
Target Synonyms
AARS2; AARSL; KIAA1270; Alanine--tRNA ligase; mitochondrial; EC 6.1.1.7; Alanyl-tRNA synthetase; AlaRS
Target Background
The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. Aminoacyl-tRNA synthetases play critical roles in mRNA translation by charging tRNAs with their cognate amino acids. The encoded protein is a mitochondrial enzyme that specifically aminoacylates alanyl-tRNA. Mutations in this gene are a cause of combined oxidative phosphorylation deficiency 8.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
