Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AASS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-600 of human AASS (NP_005754.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AASS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-600 of human AASS (NP_005754.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of lysates from Rat kidney, using AASS Rabbit pAb at 1:100 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
| Cat.No | ADA-08215A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AASS |
| Target Synonyms | AASS; LKR/SDH; LKRSDH; LORSDH; aminoadipate-semialdehyde synthase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-600 of human AASS (NP_005754.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNINPVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGE | Uniprot ID | Q9UDR5 |
Uniprot Id
Q9UDR5
Target Species
Human
Target Name
AASS
Target Full Name
Alpha-aminoadipic semialdehyde synthase, mitochondrial
Target Function
Bifunctional enzyme that catalyzes the first two steps in lysine degradation. The N-terminal and the C-terminal contain lysine-ketoglutarate reductase and saccharopine dehydrogenase activity, respectively.
Target Involvement
Hyperlysinemia, 1 (HYPLYS1); 2,4-dienoyl-CoA reductase deficiency (DECRD)
Target Subcellular Location
Mitochondrion.
Target Protein Families
AlaDH/PNT family; Saccharopine dehydrogenase family
Target Tissue Specificity
Expressed in all 16 tissues examined with highest expression in the liver.
Target Synonyms
AASSAlpha-aminoadipic semialdehyde synthase; mitochondrial; LKR/SDH) [Includes: Lysine ketoglutarate reductase; LKR; LOR; EC 1.5.1.8); Saccharopine dehydrogenase; SDH; EC 1.5.1.9)]
Target Background
This gene encodes a bifunctional enzyme that catalyzes the first two steps in the mammalian lysine degradation pathway. The N-terminal and the C-terminal portions of this enzyme contain lysine-ketoglutarate reductase and saccharopine dehydrogenase activity, respectively, resulting in the conversion of lysine to alpha-aminoadipic semialdehyde. Mutations in this gene are associated with familial hyperlysinemia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
