-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AATF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 7-100 of human AATF (NP_036270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AATF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 7-100 of human AATF (NP_036270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03631A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AATF |
| Target Synonyms | DED; BFR2; CHE1; CHE-1; AATF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Neuro-2a, RAW264.7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 7-100 of human AATF (NP_036270.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD | Uniprot ID | Q9NY61 |
Uniprot Id
Q9NY61
Target Species
Human
Target Name
AATF
Target Full Name
Protein AATF
Target Function
May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
AATF family
Target Tissue Specificity
Ubiquitously expressed. Expressed at high levels in brain, heart, kidney, placenta and thymus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AATF; AATF_HUMAN; Apoptosis antagonizing transcription factor ; Apoptosis-antagonizing transcription factor; BFR2; CHE 1; CHE1; DED; Protein AATF; Rb binding protein Che 1; Rb-binding protein Che-1
Target Background
The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Notification