-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCA6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1518-1617 of human ABCA6 (NP_525023.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCA6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1518-1617 of human ABCA6 (NP_525023.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00365A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCA6 |
| Target Synonyms | EST155051; [KD Validated] ABCA6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver, Rat liver, RAW264.7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1518-1617 of human ABCA6 (NP_525023.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQVTLVHTEILKLFPQAAGQERYSSLLTYKLPVADVYPLSQTFHKLEAVKHNFNLEEYSLSQCTLEKVFLELSKEQEVGNFDEEIDTTMRWKLLPHSDEP | Uniprot ID | Q8N139 |
Uniprot Id
Q8N139
Target Species
Human
Target Name
ABCA6
Target Full Name
ATP-binding cassette sub-family A member 6
Target Function
Probable transporter which may play a role in macrophage lipid transport and homeostasis.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCA family
Target Tissue Specificity
Widely expressed with higher expression in liver.
Target Synonyms
ABC transporter ABCA6; ABCA 6; ABCA6; ABCA6_HUMAN; ATP binding cassette A6; ATP binding cassette sub family A (ABC1) member 6; ATP binding cassette sub family A member 6; ATP-binding cassette sub-family A member 6; EST155051; FLJ43498
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis.
Notification