-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human ABCC5 (NP_005679.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human ABCC5 (NP_005679.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11672A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCC5 |
| Target Synonyms | MRP5; SMRP; ABC33; MOATC; MOAT-C; pABC11; EST277145; ABCC5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human ABCC5 (NP_005679.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL | Uniprot ID | O15440 |
Uniprot Id
O15440
Target Species
Human
Target Name
ABCC5
Target Full Name
ATP-binding cassette sub-family C member 5
Target Function
ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds, and xenobiotics from cells. Mediates ATP-dependent transport of endogenous metabolites such as cAMP and cGMP, folic acid and N-lactoyl-amino acids (in vitro). Acts also as a general glutamate conjugate and analog transporter that can limit the brain levels of endogenous metabolites, drugs, and toxins. Confers resistance to the antiviral agent PMEA. Able to transport several anticancer drugs including methotrexate, and nucleotide analogs in vitro, however it does with low affinity, thus the exact role of ABCC5 in mediating resistance still needs to be elucidated. Acts as a heme transporter required for the translocation of cytosolic heme to the secretory pathway. May play a role in energy metabolism by regulating the glucagon-like peptide 1 (GLP-1) secretion from enteroendocrine cells.
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein. Golgi apparatus lumen. Endosome membrane. Cytoplasmic granule. Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCC family, Conjugate transporter (TC 3.A.1.208) subfamily
Target Tissue Specificity
[Isoform 3]: Predominant isoform in retinal pigment epithelium, bladder, and stomach.; Ubiquitously expressed, but levels in brain and muscle are especially high. All isoforms are equally expressed in retina.
Target Synonyms
ABC 33; ABC33; ABCC 5; Abcc5; ATP binding cassette sub family C (CFTR/MRP) member 5; ATP binding cassette sub family C member 5; ATP-binding cassette sub-family C member 5; Canalicular multispecific organic anion transporter C; DKFZp686C1782; EST277145; MOAT C; MOAT-C; MOATC; MRP 5; MRP5_HUMAN; Multi specific organic anion tranporter C; Multi-specific organic anion transporter C; Multidrug resistance associated protein 5; Multidrug resistance-associated protein 5; pABC 11; pABC11; SMRP
Target Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants.
Notification