-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABI2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABI2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05324A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABI2 |
| Target Synonyms | AIP1; ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB; ABI2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRT | Uniprot ID | Q9NYB9 |
Uniprot Id
Q9NYB9
Target Species
Human
Target Name
ABI2
Target Full Name
Abl interactor 2
Target Function
Regulator of actin cytoskeleton dynamics underlying cell motility and adhesion. Functions as a component of the WAVE complex, which activates actin nucleating machinery Arp2/3 to drive lamellipodia formation. Acts as regulator and substrate of nonreceptor tyrosine kinases ABL1 and ABL2 involved in processes linked to cell growth and differentiation. Positively regulates ABL1-mediated phosphorylation of ENAH, which is required for proper polymerization of nucleated actin filaments at the leading edge. Contributes to the regulation of actin assembly at the tips of neuron projections. In particular, controls dendritic spine morphogenesis and may promote dendritic spine specification toward large mushroom-type spines known as repositories of memory in the brain. In hippocampal neurons, may mediate actin-dependent BDNF-NTRK2 early endocytic trafficking that triggers dendrite outgrowth. Participates in ocular lens morphogenesis, likely by regulating lamellipodia-driven adherens junction formation at the epithelial cell-secondary lens fiber interface. Also required for nascent adherens junction assembly in epithelial cells.
Target Subcellular Location
Cytoplasm. Nucleus.; [Isoform 1]: Cell projection, lamellipodium. Cell projection, filopodium. Cytoplasm, cytoskeleton. Cell junction, adherens junction.
Target Protein Families
ABI family
Target Tissue Specificity
Widely expressed. Abundant in testes, ovary, thymus, and colon, with lower but detectable levels in prostate, peripheral blood leukocytes, and spleen.
Target Synonyms
Abelson interactor 2; ABI 2; Abi-2; ABI2; ABI2_HUMAN; ABI2B; Abl binding protein 3; Abl interacting protein 1 (SH3 containing protein); Abl interactor 2; Abl interactor protein 2b; Abl-binding protein 3; AblBP3; AIP 1; Arg binding protein 1; Arg protein tyrosine kinase binding protein; Arg-binding protein 1; ArgBP1; ARGBPIA; ArgBPIB; OTTHUMP00000163783; OTTHUMP00000163784; OTTHUMP00000206182; OTTHUMP00000206183; OTTHUMP00000206184; OTTHUMP00000206185; SSH3BP2
Target Background
Enables several functions, including SH3 domain binding activity; identical protein binding activity; and ubiquitin protein ligase binding activity. Contributes to small GTPase binding activity. Involved in Rac protein signal transduction; positive regulation of cellular component organization; and zonula adherens assembly. Acts upstream of or within peptidyl-tyrosine phosphorylation. Located in several cellular components, including filopodium tip; lamellipodium; and nucleoplasm. Part of SCAR complex. Is active in adherens junction. Colocalizes with actin filament.
Notification