-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14245A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABL2 |
| Target Synonyms | ARG; ABLL; ABL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE | Uniprot ID | P42684 |
Uniprot Id
P42684
Target Species
Human
Target Name
ABL2
Target Full Name
Tyrosine-protein kinase ABL2
Target Function
Non-receptor tyrosine-protein kinase that plays an ABL1-overlapping role in key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion and receptor endocytosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like MYH10 (involved in movement); CTTN (involved in signaling); or TUBA1 and TUBB (microtubule subunits). Binds directly F-actin and regulates actin cytoskeletal structure through its F-actin-bundling activity. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as CRK, CRKL, DOK1 or ARHGAP35. Adhesion-dependent phosphorylation of ARHGAP35 promotes its association with RASA1, resulting in recruitment of ARHGAP35 to the cell periphery where it inhibits RHO. Phosphorylates multiple receptor tyrosine kinases like PDGFRB and other substrates which are involved in endocytosis regulation such as RIN1. In brain, may regulate neurotransmission by phosphorylating proteins at the synapse. ABL2 acts also as a regulator of multiple pathological signaling cascades during infection. Pathogens can highjack ABL2 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, ABL subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
Abelson murine leukemia viral oncogene homolog 2; Abelson related gene protein; Abelson tyrosine-protein kinase 2; Abelson-related gene protein; ABL2; ABL2_HUMAN; ABLL; ARG; Tyrosine kinase ARG; Tyrosine protein kinase ABL2; Tyrosine-protein kinase ARG; v abl Abelson murine leukemia viral oncogene homolog 2
Target Background
This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Notification