-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACAC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-75 of human ACAC1 (NP_942133.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against ACAC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-75 of human ACAC1 (NP_942133.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-08467A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACAC1 |
| Target Synonyms | ACC; ACAC; ACC1; ACCA; Acac1; hACC1; ACACAD; ACCalpha; ACACalpha; acetyl-ACC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1-75 of human ACAC1 (NP_942133.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHI | Uniprot ID | Q13085 |
Uniprot Id
Q13085
Target Species
Human
Target Name
ACACA
Target Full Name
Acetyl-CoA carboxylase 1
Target Function
Cytosolic enzyme that catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the first and rate-limiting step of de novo fatty acid biosynthesis. This is a 2 steps reaction starting with the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain followed by the transfer of the carboxyl group from carboxylated biotin to acetyl-CoA.
Target Involvement
Acetyl-CoA carboxylase 1 deficiency (ACACAD)
Target Subcellular Location
Cytoplasm, cytosol.
Target Tissue Specificity
Expressed in brain, placenta, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver.
Target Research Area
Cancer
Target Synonyms
ACAC; ACACA; ACACA_HUMAN; ACACB; ACC alpha; ACC; ACC beta ; ACC-alpha; ACC1; ACC2; ACCA; ACCB; Acetyl CoA carboxylase 1; Acetyl CoA carboxylase 2; Acetyl CoA carboxylase alpha ; Acetyl CoA carboxylase beta; Acetyl Coenzyme A carboxylase alpha; Acetyl Coenzyme A carboxylase beta; Biotin carboxylase; COA1; COA2; HACC275; OTTHUMP00000164069; OTTHUMP00000164070; OTTHUMP00000164076; OTTHUMP00000240532
Target Background
Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.
Notification