Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACAT2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACAT2 (Q9BWD1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACAT2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACAT2 (Q9BWD1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16821A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACAT2 |
| Target Synonyms | ACAT2; acetyl-CoA acetyltransferase 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, HepG2, Mouse brain, Mouse liver, Rat kidney, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACAT2 (Q9BWD1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPAN | Uniprot ID | Q9BWD1 |
Uniprot Id
Q9BWD1
Target Species
Human
Target Name
ACAT2
Target Full Name
Acetyl-CoA acetyltransferase, cytosolic
Target Function
Involved in the biosynthetic pathway of cholesterol.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Thiolase family
Target Research Area
Metabolism
Target Synonyms
Acat2; acetoacetyl CoA thiolase; acetoacetyl Coenzyme A thiolase; Acetyl CoA acetyltransferase; Acetyl CoA transferase like protein ; acetyl Coenzyme A acetyltransferase 2 ; Acetyl-CoA acetyltransferase; Acetyl-CoA transferase-like protein; Acyl Coenzyme A cholesterol acyltransferase 2; Cytosolic acetoacetyl-CoA thiolase; cytosolic; SOAT2; THIC_HUMAN
Target Background
The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
