-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACLY was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1101 of human ACLY (P53396) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against ACLY was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1101 of human ACLY (P53396) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-16578A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACLY |
| Target Synonyms | ACL; ATPCL; CLATP; ACLY | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Jurkat, Mouse brain, Mouse liver, Mouse lung, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1101 of human ACLY (P53396). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMSM | Uniprot ID | P53396 |
Uniprot Id
P53396
Target Species
Human
Target Name
ACLY
Target Full Name
ATP-citrate synthase
Target Function
Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Succinate/malate CoA ligase beta subunit family; Succinate/malate CoA ligase alpha subunit family
Target Research Area
Metabolism
Target Synonyms
ACL; Acly; ACLY_HUMAN; ATP citrate (pro-S) lyase; ATP citrate lyase; ATP citrate synthase; ATP-citrate (pro-S-)-lyase; ATP-citrate synthase; ATPcitrate synthase; ATPCL; Citrate cleavage enzyme; CLATP; OTTHUMP00000164773
Target Background
ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440, 000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Notification